FBXO11 anticorps (Middle Region)

N° du produit ABIN631382

L’anticorps Lapin Polyclonal anti-FBXO11 a été validé pour WB. Il convient pour détecter FBXO11 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FBXO11 anticorps (Middle Region) (ABIN631382)

Antigène: FBXO11 (F-Box Protein 11 (FBXO11))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO11 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBXO11 anticorps

Épitope: Middle Region

Specificité: FBXO11 antibody was raised against the middle region of FBXO11

Purification: Affinity purified

Immunogène: FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO11 Blocking Peptide, (ABIN939099), is also available for use as a blocking control in assays to test for specificity of this FBXO11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO11

Antigène: FBXO11 (F-Box Protein 11 (FBXO11))

Autre désignation: FBXO11

Sujet: FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Poids moléculaire: 94 kDa (MW of target protein)

Pathways: Sensory Perception of Sound