FBXO11 anticorps (Middle Region)

N° du produit ABIN631382

Détail du produit anti-FBXO11 anticorps

Antigène: FBXO11 (F-Box Protein 11 (FBXO11))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO11 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO11 antibody was raised against the middle region of FBXO11

Purification: Affinity purified

Immunogène: FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO11 Blocking Peptide, catalog no. 33R-3713, is also available for use as a blocking control in assays to test for specificity of this FBXO11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO11

Antigène: FBXO11 (F-Box Protein 11 (FBXO11))

Autre désignation: FBXO11 (FBXO11 Produits)

Synonymes: anticorps FBX11, anticorps PRMT9, anticorps UBR6, anticorps VIT1, anticorps C80048, anticorps Jf, anticorps Vit1, anticorps fbxo11, anticorps MGC84634, anticorps FBXO11, anticorps im:6906507, anticorps wu:fj83f06, anticorps zgc:153171, anticorps Fbxo11, anticorps DKFZp459P2410, anticorps F-box protein 11, anticorps F-box protein 11 L homeolog, anticorps F-box protein 11a, anticorps F-box only protein 11, anticorps hypothetical protein, anticorps FBXO11, anticorps Fbxo11, anticorps fbxo11.L, anticorps fbxo11a, anticorps CpipJ_CPIJ009919, anticorps CpipJ_CPIJ017549, anticorps Bm1_52225, anticorps LOAG_16571, anticorps fbxo11, anticorps LOC100115478

Sujet: FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Poids moléculaire: 94 kDa (MW of target protein)

Pathways: Sensory Perception of Sound