RSPRY1 anticorps (N-Term)

N° du produit ABIN631386

Cet anticorps anti-RSPRY1 est un anticorps Lapin Polyclonal détectant RSPRY1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RSPRY1 anticorps (N-Term) (ABIN631386)

Antigène: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSPRY1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RSPRY1 anticorps

Épitope: N-Term

Specificité: RSPRY1 antibody was raised against the N terminal of RSPRY1

Purification: Affinity purified

Immunogène: RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RSPRY1 Blocking Peptide, (ABIN5615968), is also available for use as a blocking control in assays to test for specificity of this RSPRY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPRY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSPRY1

Antigène: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Autre désignation: RSPRY1

Sujet: RSPRY1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of RSPRY1 remains unknown.

Poids moléculaire: 64 kDa (MW of target protein)