TRIM43 anticorps (C-Term)

N° du produit ABIN631387

Cet anticorps Lapin Polyclonal détecte spécifiquement TRIM43 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TRIM43 anticorps (C-Term) (ABIN631387)

Antigène: TRIM43 (Tripartite Motif Containing 43 (TRIM43))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM43 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TRIM43 anticorps

Épitope: C-Term

Specificité: TRIM43 antibody was raised against the C terminal of TRIM43

Purification: Affinity purified

Immunogène: TRIM43 antibody was raised using the C terminal of TRIM43 corresponding to a region with amino acids NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM43 Blocking Peptide, (ABIN5616781), is also available for use as a blocking control in assays to test for specificity of this TRIM43 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM43

Antigène: TRIM43 (Tripartite Motif Containing 43 (TRIM43))

Autre désignation: TRIM43

Sujet: TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.

Poids moléculaire: 52 kDa (MW of target protein)