RNF168 anticorps (C-Term)

N° du produit ABIN631390

Cet anticorps Lapin Polyclonal détecte spécifiquement RNF168 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Chien et Rat.

Aperçu rapide pour RNF168 anticorps (C-Term) (ABIN631390)

Antigène: RNF168 (Ring Finger Protein 168 (RNF168))

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF168 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RNF168 anticorps

Épitope: C-Term

Specificité: RNF168 antibody was raised against the C terminal of RNF168

Purification: Affinity purified

Immunogène: RNF168 antibody was raised using the C terminal of RNF168 corresponding to a region with amino acids PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF168 Blocking Peptide, (ABIN5615894), is also available for use as a blocking control in assays to test for specificity of this RNF168 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF168 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF168

Antigène: RNF168 (Ring Finger Protein 168 (RNF168))

Autre désignation: RNF168

Sujet: The complex repair response elicited by DNA double-strand breaks (DSBs) includes recruitment of several DNA repair proteins and ubiquitination of H2A-type histones. RNF168 is an E3 ubiquitin ligase critical for DSB repair.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response