TRIM60 anticorps (N-Term)

N° du produit ABIN631391

Détail du produit anti-TRIM60 anticorps

Antigène: TRIM60 (Tripartite Motif Containing 60 (TRIM60))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM60 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM60 antibody was raised against the N terminal of TRIM60

Purification: Affinity purified

Immunogène: TRIM60 antibody was raised using the N terminal of TRIM60 corresponding to a region with amino acids LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM60 Blocking Peptide, catalog no. 33R-4900, is also available for use as a blocking control in assays to test for specificity of this TRIM60 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM60

Antigène: TRIM60 (Tripartite Motif Containing 60 (TRIM60))

Autre désignation: TRIM60 (TRIM60 Produits)

Synonymes: anticorps RNF129, anticorps RNF33, anticorps 2czf45, anticorps Rnf33, anticorps tripartite motif containing 60, anticorps tripartite motif-containing 60, anticorps TRIM60, anticorps Trim60

Sujet: TRIM60 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Poids moléculaire: 55 kDa (MW of target protein)