RNF169 anticorps (N-Term)

N° du produit ABIN631397

Détail du produit anti-RNF169 anticorps

Antigène: RNF169 (Ring Finger Protein 169 (RNF169))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF169 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF169 antibody was raised against the N terminal of RNF169

Purification: Affinity purified

Immunogène: RNF169 antibody was raised using the N terminal of RNF169 corresponding to a region with amino acids DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF169 Blocking Peptide, catalog no. 33R-2192, is also available for use as a blocking control in assays to test for specificity of this RNF169 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF169

Antigène: RNF169 (Ring Finger Protein 169 (RNF169))

Autre désignation: RNF169 (RNF169 Produits)

Synonymes: anticorps 2900057K09Rik, anticorps ring finger protein 169, anticorps RNF169, anticorps Rnf169

Sujet: The function of RNF169 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 77 kDa (MW of target protein)