GLYATL3 anticorps (N-Term)

N° du produit ABIN631402

Détail du produit anti-GLYATL3 anticorps

Antigène: GLYATL3 (Glycine-N-Acyltransferase-Like 3 (GLYATL3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLYATL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: C6 ORF140 antibody was raised against the N terminal Of C6 rf140

Purification: Affinity purified

Immunogène: C6 ORF140 antibody was raised using the N terminal Of C6 rf140 corresponding to a region with amino acids NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C6ORF140 Blocking Peptide, catalog no. 33R-6816, is also available for use as a blocking control in assays to test for specificity of this C6ORF140 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLYATL3

Antigène: GLYATL3 (Glycine-N-Acyltransferase-Like 3 (GLYATL3))

Autre désignation: C6ORF140 (GLYATL3 Produits)

Synonymes: anticorps C6orf140, anticorps bA28H17.2, anticorps Gm5683, anticorps EG435528, anticorps glycine-N-acyltransferase like 3, anticorps glycine-N-acyltransferase-like 3, anticorps GLYATL3, anticorps Glyatl3

Sujet: C6orf140 encodes an acyltransferase which transfers the acyl group to the N-terminus of glycine.

Poids moléculaire: 33 kDa (MW of target protein)