FAU anticorps
-
- Antigène Voir toutes FAU Anticorps
- FAU (Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAU est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FAU antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
- Top Product
- Discover our top product FAU Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAU Blocking Peptide, catalog no. 33R-9774, is also available for use as a blocking control in assays to test for specificity of this FAU antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAU antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAU (Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU))
- Autre désignation
- FAU (FAU Produits)
- Synonymes
- anticorps FAU1, anticorps Fub1, anticorps Fubi, anticorps MNSFbeta, anticorps RPS30, anticorps S30, anticorps asr1, anticorps Asr1, anticorps MGC73171, anticorps zgc:73171, anticorps FAU, ubiquitin like and ribosomal protein S30 fusion, anticorps Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived), anticorps Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed a, anticorps FAU, anticorps Fau, anticorps faua
- Sujet
- FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.
- Poids moléculaire
- 14 kDa (MW of target protein)
-