KLHL9 anticorps

N° du produit ABIN631406

Détail du produit anti-KLHL9 anticorps

Antigène: KLHL9 (Kelch-Like 9 (KLHL9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHL9 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: KLHL9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHL9 Blocking Peptide, catalog no. 33R-8307, is also available for use as a blocking control in assays to test for specificity of this KLHL9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHL9

Antigène: KLHL9 (Kelch-Like 9 (KLHL9))

Autre désignation: KLHL9 (KLHL9 Produits)

Synonymes: anticorps 8030469P05, anticorps C530050O22Rik, anticorps ENSMUSG00000070923, anticorps mKIAA1354, anticorps RGD1304814, anticorps kelch-like 9, anticorps kelch-like family member 9, anticorps kelch like family member 9, anticorps Klhl9, anticorps KLHL9

Sujet: KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression.

Poids moléculaire: 69 kDa (MW of target protein)