KLHL15 anticorps

N° du produit ABIN631407

Cet anticorps anti-KLHL15 est un anticorps Lapin Polyclonal détectant KLHL15 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour KLHL15 anticorps (ABIN631407)

Antigène: KLHL15 (Kelch-Like 15 (KLHL15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHL15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KLHL15 anticorps

Purification: Affinity purified

Immunogène: KLHL15 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHL15 Blocking Peptide, (ABIN5614377), is also available for use as a blocking control in assays to test for specificity of this KLHL15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHL15

Antigène: KLHL15 (Kelch-Like 15 (KLHL15))

Autre désignation: KLHL15

Sujet: KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.

Poids moléculaire: 66 kDa (MW of target protein)