alpha Actinin 4 anticorps (C-Term)

N° du produit ABIN631408

Détail du produit anti-alpha Actinin 4 anticorps

Antigène: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp alpha Actinin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Alpha Actinin 4 antibody was raised against the C terminal of ACTN4

Purification: Affinity purified

Immunogène: alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Alpha Actinin 4 Blocking Peptide, catalog no. 33R-2213, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur alpha Actinin 4

Antigène: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Autre désignation: alpha Actinin 4 (ACTN4 Produits)

Synonymes: anticorps fsgs, anticorps fsgs1, anticorps C77391, anticorps ACTININ-4, anticorps FSGS, anticorps FSGS1, anticorps wu:fb53f05, anticorps zgc:63508, anticorps actinin alpha 4, anticorps actinin, alpha 4, anticorps actinin alpha 4 S homeolog, anticorps actn4, anticorps ACTN4, anticorps Actn4, anticorps actn4.S

Sujet: Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.

Poids moléculaire: 105 kDa (MW of target protein)

Pathways: Proton Transport