EPB41 anticorps (N-Term)

N° du produit ABIN631411

Détail du produit anti-EPB41 anticorps

Antigène: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPB41 est non-conjugé

Application: Western Blotting (WB)

Specificité: EPB41 antibody was raised against the N terminal of EPB41

Purification: Affinity purified

Immunogène: EPB41 antibody was raised using the N terminal of EPB41 corresponding to a region with amino acids SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPB41 Blocking Peptide, catalog no. 33R-8404, is also available for use as a blocking control in assays to test for specificity of this EPB41 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB41 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPB41

Antigène: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Autre désignation: EPB41 (EPB41 Produits)

Synonymes: anticorps P4.1R, anticorps epb41, anticorps wu:fb70c02, anticorps EPB41, anticorps el1, anticorps 4.1r, anticorps 4.1R, anticorps EL1, anticorps HE, anticorps AI415518, anticorps D4Ertd442e, anticorps Elp-1, anticorps Elp1, anticorps Epb41, anticorps mKIAA4056, anticorps erythrocyte membrane protein band 4.1b, anticorps erythrocyte membrane protein band 4.1, anticorps erythrocyte membrane protein band 4.1 L homeolog, anticorps epb41b, anticorps EPB41, anticorps epb41, anticorps epb41.L, anticorps Epb41

Sujet: Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene, the beta-spectrin gene, or the band 3 gene.

Poids moléculaire: 85 kDa (MW of target protein)