ARCN1 anticorps (Middle Region)

N° du produit ABIN631413

Détail du produit anti-ARCN1 anticorps

Antigène: ARCN1 (Archain 1 (ARCN1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARCN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Archain 1 antibody was raised against the middle region of ARCN1

Purification: Affinity purified

Immunogène: Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Archain 1 Blocking Peptide, catalog no. 33R-3292, is also available for use as a blocking control in assays to test for specificity of this Archain 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARCN1

Antigène: ARCN1 (Archain 1 (ARCN1))

Autre désignation: Archain 1 (ARCN1 Produits)

Synonymes: anticorps copd, anticorps Tb08.5H5.420, anticorps COPD, anticorps 4632432M07Rik, anticorps nur17, anticorps arcn1, anticorps cb334, anticorps id:ibd3027, anticorps archain 1, anticorps coatomer delta subunit, anticorps coatomer subunit delta, anticorps Coatomer delta subunit, anticorps archain 1 L homeolog, anticorps archain 1a, anticorps ARCN1, anticorps arcn1, anticorps Arcn1, anticorps Tc00.1047053503581.39, anticorps Tc00.1047053506573.91, anticorps Tc00.1047053511217.140, anticorps Tb927.8.5250, anticorps PVX_092350, anticorps LOC5577486, anticorps GL50803_6170, anticorps NAEGRDRAFT_79018, anticorps CC1G_00709, anticorps arcn1.L, anticorps arcn1a

Sujet: The gene that encodes ARCN1 maps in a region, which includes the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. ARCN1 is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.

Poids moléculaire: 57 kDa (MW of target protein)