TNKS anticorps (Middle Region)

N° du produit ABIN631422

Cet anticorps anti-TNKS est un anticorps Lapin Polyclonal détectant TNKS dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour TNKS anticorps (Middle Region) (ABIN631422)

Antigène: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNKS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TNKS anticorps

Épitope: Middle Region

Specificité: TNKS antibody was raised against the middle region of TNKS

Purification: Affinity purified

Immunogène: TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TNKS Blocking Peptide, (ABIN940434), is also available for use as a blocking control in assays to test for specificity of this TNKS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNKS

Antigène: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Autre désignation: TNKS

Sujet: TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.

Poids moléculaire: 142 kDa (MW of target protein)