Pallidin anticorps

N° du produit ABIN631430

L’anticorps anti-Pallidin Polyclonal Lapin est utilisé pour la détection de Pallidin dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour Pallidin anticorps (ABIN631430)

Antigène: Pallidin (PLDN) (Pallidin Homolog (PLDN))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pallidin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Pallidin anticorps

Purification: Affinity purified

Immunogène: PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLDN Blocking Peptide, (ABIN5615411), is also available for use as a blocking control in assays to test for specificity of this PLDN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLDN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pallidin

Antigène: Pallidin (PLDN) (Pallidin Homolog (PLDN))

Autre désignation: PLDN

Sujet: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Synaptic Vesicle Exocytosis