Pallidin anticorps

N° du produit ABIN631430

Détail du produit anti-Pallidin anticorps

Antigène: Pallidin (PLDN) (Pallidin Homolog (PLDN))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pallidin est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLDN Blocking Peptide, catalog no. 33R-6524, is also available for use as a blocking control in assays to test for specificity of this PLDN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLDN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pallidin

Antigène: Pallidin (PLDN) (Pallidin Homolog (PLDN))

Autre désignation: PLDN (PLDN Produits)

Synonymes: anticorps CG14133, anticorps Dmel\\CG14133, anticorps LOC100226487, anticorps pldn, anticorps BLOS6, anticorps HPS9, anticorps PA, anticorps PALLID, anticorps PLDN, anticorps Pldn, anticorps BLOC-1, anticorps Stx13bp1, anticorps pa, anticorps pallidin, anticorps CG14133 gene product from transcript CG14133-RB, anticorps biogenesis of lysosomal organelles complex 1 subunit 6, anticorps pallidin homolog (mouse), anticorps biogenesis of lysosomal organelles complex-1, subunit 6, pallidin, anticorps Pallidin, anticorps BLOC1S6, anticorps pldn, anticorps Bloc1s6

Sujet: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Synaptic Vesicle Exocytosis