Sec8 anticorps (N-Term)

N° du produit ABIN631432

Détail du produit anti-Sec8 anticorps

Antigène: Sec8 (EXOC4) (Exocyst Complex Component 4 (EXOC4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sec8 est non-conjugé

Application: Western Blotting (WB)

Specificité: EXOC4 antibody was raised against the N terminal of EXOC4

Purification: Affinity purified

Immunogène: EXOC4 antibody was raised using the N terminal of EXOC4 corresponding to a region with amino acids MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOC4 Blocking Peptide, catalog no. 33R-5589, is also available for use as a blocking control in assays to test for specificity of this EXOC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sec8

Antigène: Sec8 (EXOC4) (Exocyst Complex Component 4 (EXOC4))

Autre désignation: EXOC4 (EXOC4 Produits)

Sujet: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis