ASL anticorps (N-Term)

N° du produit ABIN631440

Cet anticorps anti-ASL est un anticorps Lapin Polyclonal détectant ASL dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ASL anticorps (N-Term) (ABIN631440)

Antigène: ASL (Argininosuccinate Lyase (ASL))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ASL anticorps

Épitope: N-Term

Specificité: ASL antibody was raised against the N terminal of ASL

Purification: Affinity purified

Immunogène: ASL antibody was raised using the N terminal of ASL corresponding to a region with amino acids GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASL Blocking Peptide, (ABIN938561), is also available for use as a blocking control in assays to test for specificity of this ASL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASL

Antigène: ASL (Argininosuccinate Lyase (ASL))

Autre désignation: ASL

Sujet: ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus