Glycogen Synthase 2 anticorps

N° du produit ABIN631445

Détail du produit anti-Glycogen Synthase 2 anticorps

Antigène: Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glycogen Synthase 2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Glycogen Synthase 2 Blocking Peptide, catalog no. 33R-9185, is also available for use as a blocking control in assays to test for specificity of this Glycogen Synthase 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GYS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glycogen Synthase 2

Antigène: Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))

Autre désignation: Glycogen Synthase 2 (GYS2 Produits)

Synonymes: anticorps cb765, anticorps zgc:112057, anticorps BC021322, anticorps LGS, anticorps GLYSN, anticorps glycogen synthase 2, anticorps gys2, anticorps Gys2, anticorps GYS2

Sujet: GYS2 transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.

Poids moléculaire: 81 kDa (MW of target protein)

Pathways: AMPK Signaling, Cellular Glucan Metabolic Process