HGD anticorps

N° du produit ABIN631446

Cet anticorps anti-HGD Polyclonal Lapin (ABIN631446) détecte spécifiquement HGD dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour HGD anticorps (ABIN631446)

Antigène: HGD (Homogentisate 1,2-Dioxygenase (HGD))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HGD est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HGD anticorps

Purification: Affinity purified

Immunogène: HGD antibody was raised using a synthetic peptide corresponding to a region with amino acids KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HGD Blocking Peptide, (ABIN939893), is also available for use as a blocking control in assays to test for specificity of this HGD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HGD

Antigène: HGD (Homogentisate 1,2-Dioxygenase (HGD))

Autre désignation: HGD

Sujet: Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver.

Poids moléculaire: 50 kDa (MW of target protein)