PARP9 anticorps

N° du produit ABIN631447

Cet anticorps Lapin Polyclonal détecte spécifiquement PARP9 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour PARP9 anticorps (ABIN631447)

Antigène: PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARP9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PARP9 anticorps

Purification: Affinity purified

Immunogène: PARP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARP9 Blocking Peptide, (ABIN940399), is also available for use as a blocking control in assays to test for specificity of this PARP9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARP9

Antigène: PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))

Autre désignation: PARP9

Sujet: PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown.

Poids moléculaire: 96 kDa (MW of target protein)