MYH10 anticorps (N-Term)

N° du produit ABIN631458

Cet anticorps anti-MYH10 est un anticorps Lapin Polyclonal détectant MYH10 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour MYH10 anticorps (N-Term) (ABIN631458)

Antigène: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYH10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MYH10 anticorps

Épitope: N-Term

Specificité: MYH10 antibody was raised against the N terminal of MYH10

Purification: Affinity purified

Immunogène: MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYH10 Blocking Peptide, (ABIN5614894), is also available for use as a blocking control in assays to test for specificity of this MYH10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYH10

Antigène: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Autre désignation: MYH10

Sujet: MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.

Poids moléculaire: 229 kDa (MW of target protein)