BPGM anticorps (Middle Region)
-
- Antigène Voir toutes BPGM Anticorps
- BPGM (2,3-bisphosphoglycerate Mutase (BPGM))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BPGM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BPGM antibody was raised against the middle region of BPGM
- Purification
- Affinity purified
- Immunogène
- BPGM antibody was raised using the middle region of BPGM corresponding to a region with amino acids EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK
- Top Product
- Discover our top product BPGM Anticorps primaire
-
anti-2,3-bisphosphoglycerate Mutase (BPGM) (AA 1-259) antibody
BPGM Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) antibodyBPGM Reactivité: Humain, Souris WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) antibodyBPGM Reactivité: Humain WB, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) (AA 1-259) antibodyBPGM Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) (AA 85-216) antibodyBPGM Reactivité: Souris WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) (AA 230-259), (C-Term) antibodyBPGM Reactivité: Humain WB Hôte: Lapin Polyclonal RB32095 unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) (AA 110-159) antibodyBPGM Reactivité: Humain, Souris, Rat, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) (C-Term) antibodyBPGM Reactivité: Humain, Rat, Boeuf (Vache), Cobaye, Cheval, Lapin, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) (AA 1-246) antibodyBPGM Reactivité: Humain, Souris WB, IHC, IHC (p), ICC Hôte: Lapin Polyclonal unconjugated
anti-2,3-bisphosphoglycerate Mutase (BPGM) (AA 29-242) antibodyBPGM Reactivité: Humain WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BPGM Blocking Peptide, catalog no. 33R-2684, is also available for use as a blocking control in assays to test for specificity of this BPGM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPGM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BPGM (2,3-bisphosphoglycerate Mutase (BPGM))
- Autre désignation
- BPGM (BPGM Produits)
- Synonymes
- anticorps DPGM, anticorps AI323730, anticorps AL022789, anticorps C86192, anticorps Ab2-098, anticorps zgc:92230, anticorps Bisphosphoglycerate mutase, anticorps bisphosphoglycerate mutase, anticorps 2,3-bisphosphoglycerate mutase, anticorps bisphosphoglycerate mutase S homeolog, anticorps pmge, anticorps BPGM, anticorps Bpgm, anticorps bpgm, anticorps bpgm.S
- Sujet
- BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration.
- Poids moléculaire
- 28 kDa (MW of target protein)
-
