RDM1 anticorps (Middle Region)

N° du produit ABIN631469

Détail du produit anti-RDM1 anticorps

Antigène: RDM1 (RAD52 Motif 1 (RDM1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RDM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RDM1 antibody was raised against the middle region of RDM1

Purification: Affinity purified

Immunogène: RDM1 antibody was raised using the middle region of RDM1 corresponding to a region with amino acids NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDM1 Blocking Peptide, catalog no. 33R-6889, is also available for use as a blocking control in assays to test for specificity of this RDM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RDM1

Antigène: RDM1 (RAD52 Motif 1 (RDM1))

Autre désignation: RDM1 (RDM1 Produits)

Synonymes: anticorps RAD52B, anticorps 2410008M22Rik, anticorps AW212028, anticorps Rad52b, anticorps RDM1, anticorps rad52b, anticorps RAD52 motif containing 1, anticorps RAD52 motif 1, anticorps RDM1, anticorps Rdm1, anticorps rdm1

Sujet: RDM1 is a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. It contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization.

Poids moléculaire: 26 kDa (MW of target protein)