COG2 anticorps (N-Term)

N° du produit ABIN631472

Détail du produit anti-COG2 anticorps

Antigène: COG2 (Conserved oligomeric Golgi complex subunit 2 (COG2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COG2 est non-conjugé

Application: Western Blotting (WB)

Specificité: COG2 antibody was raised against the N terminal of COG2

Purification: Affinity purified

Immunogène: COG2 antibody was raised using the N terminal of COG2 corresponding to a region with amino acids KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COG2 Blocking Peptide, catalog no. 33R-4640, is also available for use as a blocking control in assays to test for specificity of this COG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COG2

Antigène: COG2 (Conserved oligomeric Golgi complex subunit 2 (COG2))

Autre désignation: COG2 (COG2 Produits)

Synonymes: anticorps zC8A9.2, anticorps zgc:56436, anticorps LDLC, anticorps 1190002B08Rik, anticorps 2700012E02Rik, anticorps C86089, anticorps Ldlc, anticorps component of oligomeric golgi complex 2, anticorps cog2, anticorps COG2, anticorps Cog2

Sujet: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2.

Poids moléculaire: 83 kDa (MW of target protein)