CDC42EP4 anticorps

N° du produit ABIN631473

Cet anticorps anti-CDC42EP4 Polyclonal Lapin (ABIN631473) détecte spécifiquement CDC42EP4 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour CDC42EP4 anticorps (ABIN631473)

Antigène: CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDC42EP4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CDC42EP4 anticorps

Purification: Affinity purified

Immunogène: CDC42 EP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDC42EP4 Blocking Peptide, (ABIN5612776), is also available for use as a blocking control in assays to test for specificity of this CDC42EP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 P4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDC42EP4

Antigène: CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))

Autre désignation: CDC42EP4

Sujet: CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.

Poids moléculaire: 38 kDa (MW of target protein)