CDC42EP4 anticorps
-
- Antigène Voir toutes CDC42EP4 Anticorps
- CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CDC42EP4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CDC42 EP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ
- Top Product
- Discover our top product CDC42EP4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CDC42EP4 Blocking Peptide, catalog no. 33R-8850, is also available for use as a blocking control in assays to test for specificity of this CDC42EP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 P4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))
- Autre désignation
- CDC42EP4 (CDC42EP4 Produits)
- Synonymes
- anticorps cdc42ep4, anticorps zgc:91889, anticorps wu:fb55a05, anticorps cep4, anticorps borg4, anticorps kaia1777, anticorps BORG4, anticorps CEP4, anticorps KAIA1777, anticorps 1500041M20Rik, anticorps Borg4, anticorps CDC42 effector protein 4, anticorps CDC42 effector protein (Rho GTPase binding) 4a, anticorps CDC42 effector protein 4 L homeolog, anticorps CDC42 effector protein (Rho GTPase binding) 4, anticorps CDC42EP4, anticorps cdc42ep4a, anticorps cdc42ep4, anticorps cdc42ep4.L, anticorps Cdc42ep4
- Sujet
- CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.
- Poids moléculaire
- 38 kDa (MW of target protein)
-