LAP3 anticorps (N-Term)

N° du produit ABIN631475

L’anticorps Lapin Polyclonal anti-LAP3 a été validé pour WB. Il convient pour détecter LAP3 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour LAP3 anticorps (N-Term) (ABIN631475)

Antigène: LAP3 (Cytosol Aminopeptidase (LAP3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LAP3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LAP3 anticorps

Épitope: N-Term

Specificité: LAP3 antibody was raised against the N terminal of LAP3

Purification: Affinity purified

Immunogène: LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAP3 Blocking Peptide, (ABIN5614413), is also available for use as a blocking control in assays to test for specificity of this LAP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LAP3

Antigène: LAP3 (Cytosol Aminopeptidase (LAP3))

Autre désignation: LAP3

Sujet: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Poids moléculaire: 56 kDa (MW of target protein)