LAP3 anticorps (N-Term)

N° du produit ABIN631475

Détail du produit anti-LAP3 anticorps

Antigène: LAP3 (Cytosol Aminopeptidase (LAP3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LAP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: LAP3 antibody was raised against the N terminal of LAP3

Purification: Affinity purified

Immunogène: LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAP3 Blocking Peptide, catalog no. 33R-5225, is also available for use as a blocking control in assays to test for specificity of this LAP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LAP3

Antigène: LAP3 (Cytosol Aminopeptidase (LAP3))

Autre désignation: LAP3 (LAP3 Produits)

Synonymes: anticorps LAP, anticorps LAPEP, anticorps PEPS, anticorps 2410015L10Rik, anticorps AA410100, anticorps LAP-3, anticorps Lap, anticorps Lapep, anticorps Pep-7, anticorps Pep-S, anticorps Pep7, anticorps Peps, anticorps cytosol aminopeptidase, anticorps leucine aminopeptidase 3, anticorps pepA, anticorps Plabr_1567, anticorps Dester_0800, anticorps Weevi_0186, anticorps Marky_0570, anticorps Halhy_2623, anticorps FsymDg_3217, anticorps Flexsi_2186, anticorps Runsl_3980, anticorps lap3, anticorps LAP3, anticorps Lap3

Sujet: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Poids moléculaire: 56 kDa (MW of target protein)