Calretinin anticorps (N-Term)

N° du produit ABIN631478

Détail du produit anti-Calretinin anticorps

Antigène: Calretinin (CALB2) (Calbindin 2 (CALB2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Calretinin est non-conjugé

Application: Western Blotting (WB)

Specificité: Calbindin 2 antibody was raised against the N terminal of CALB2

Purification: Affinity purified

Immunogène: Calbindin 2 antibody was raised using the N terminal of CALB2 corresponding to a region with amino acids IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calbindin 2 Blocking Peptide, catalog no. 33R-3997, is also available for use as a blocking control in assays to test for specificity of this Calbindin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Calretinin

Antigène: Calretinin (CALB2) (Calbindin 2 (CALB2))

Autre désignation: Calbindin 2 (CALB2 Produits)

Synonymes: anticorps CAB29, anticorps CAL2, anticorps CR, anticorps calb2l, anticorps wu:fq18e08, anticorps zgc:73115, anticorps calb2, anticorps wu:fq17g09, anticorps zgc:73099, anticorps calbindin 2, anticorps calbindin 2a, anticorps calbindin 2b, anticorps CALB2, anticorps Calb2, anticorps calb2a, anticorps calb2b

Sujet: CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.

Poids moléculaire: 30 kDa (MW of target protein)