LRRC6 anticorps (Middle Region)
-
- Antigène Voir toutes LRRC6 Anticorps
- LRRC6 (Leucine Rich Repeat Containing 6 (LRRC6))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRRC6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRRC6 antibody was raised against the middle region of LRRC6
- Purification
- Affinity purified
- Immunogène
- LRRC6 antibody was raised using the middle region of LRRC6 corresponding to a region with amino acids MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE
- Top Product
- Discover our top product LRRC6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRC6 Blocking Peptide, catalog no. 33R-6170, is also available for use as a blocking control in assays to test for specificity of this LRRC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRRC6 (Leucine Rich Repeat Containing 6 (LRRC6))
- Autre désignation
- LRRC6 (LRRC6 Produits)
- Synonymes
- anticorps LRTP, anticorps Lrtp, anticorps Tslrp, anticorps CILD19, anticorps TSLRP, anticorps lrrc6l, anticorps leucine rich repeat containing 6 (testis), anticorps leucine rich repeat containing 6, anticorps Lrrc6, anticorps LRRC6, anticorps lrrc6
- Sujet
- LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.
- Poids moléculaire
- 51 kDa (MW of target protein)
- Pathways
- M Phase
-