TUBA4A anticorps (Middle Region)

N° du produit ABIN631484

L’anticorps Lapin Polyclonal anti-TUBA4A a été validé pour WB. Il convient pour détecter TUBA4A dans des échantillons de Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis et C. elegans.

Aperçu rapide pour TUBA4A anticorps (Middle Region) (ABIN631484)

Antigène: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBA4A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TUBA4A anticorps

Épitope: Middle Region

Specificité: Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4

Purification: Affinity purified

Immunogène: alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

alpha Tubulin 4A Blocking Peptide, (ABIN938687), is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBA4A

Antigène: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Autre désignation: alpha Tubulin 4A

Sujet: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Dynamique des Microtubules, M Phase