TUBA4A anticorps (Middle Region)

N° du produit ABIN631484

Détail du produit anti-TUBA4A anticorps

Antigène: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBA4A est non-conjugé

Application: Western Blotting (WB)

Specificité: Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4

Purification: Affinity purified

Immunogène: alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

alpha Tubulin 4A Blocking Peptide, catalog no. 33R-3301, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBA4A

Antigène: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Autre désignation: alpha Tubulin 4A (TUBA4A Produits)

Synonymes: anticorps TUBA1, anticorps TUBA6, anticorps H2-ALPHA, anticorps M[a]4, anticorps Tuba4, anticorps tuba1, anticorps tubulin alpha 1a, anticorps tubulin alpha 4a, anticorps tubulin, alpha 4A, anticorps tubulin alpha 4a L homeolog, anticorps TUBA1A, anticorps TUBA4A, anticorps Tuba4a, anticorps tuba4a.L

Sujet: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Dynamique des Microtubules, M Phase