Hydroxyacid Oxidase 2 (HAO2) anticorps

N° du produit ABIN631486

Détail du produit

Antigène: Hydroxyacid Oxidase 2 (HAO2)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HAO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAO2 Blocking Peptide, catalog no. 33R-1885, is also available for use as a blocking control in assays to test for specificity of this HAO2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Hydroxyacid Oxidase 2 (HAO2)

Autre désignation: HAO2 (HAO2 Produits)

Synonymes: anticorps GIG16, anticorps HAOX2, anticorps AI325478, anticorps Hao-2, anticorps Hao3, anticorps Haox3, anticorps zgc:63690, anticorps hao2, anticorps hydroxyacid oxidase 2, anticorps hydroxyacid oxidase 2 (long chain), anticorps hydroxyacid oxidase 2 (long chain) S homeolog, anticorps HAO2, anticorps Hao2, anticorps hao2, anticorps hao2.S

Sujet: HAO2 is one of three related proteins that have 2-hydroxyacid oxidase activity yet differ in amino acid sequence, tissue expression and substrate preference. Subcellular location of the protein is the peroxisome. Specifically, the protein is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process