Hydroxyacid Oxidase 2 (HAO2) anticorps

N° du produit ABIN631486

Cet anticorps Lapin Polyclonal détecte spécifiquement Hydroxyacid Oxidase 2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Hydroxyacid Oxidase 2 (HAO2) anticorps (ABIN631486)

Antigène: Hydroxyacid Oxidase 2 (HAO2)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Purification: Affinity purified

Immunogène: HAO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAO2 Blocking Peptide, (ABIN937271), is also available for use as a blocking control in assays to test for specificity of this HAO2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Hydroxyacid Oxidase 2 (HAO2)

Autre désignation: HAO2

Sujet: HAO2 is one of three related proteins that have 2-hydroxyacid oxidase activity yet differ in amino acid sequence, tissue expression and substrate preference. Subcellular location of the protein is the peroxisome. Specifically, the protein is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process