TSH receptor anticorps (C-Term)

N° du produit ABIN631488

Cet anticorps anti-TSH receptor est un anticorps Lapin Polyclonal détectant TSH receptor dans WB. Adapté pour Humain.

Aperçu rapide pour TSH receptor anticorps (C-Term) (ABIN631488)

Antigène: TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSH receptor est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TSH receptor anticorps

Épitope: C-Term

Specificité: TSHR antibody was raised against the C terminal of TSHR

Purification: Affinity purified

Immunogène: TSHR antibody was raised using the C terminal of TSHR corresponding to a region with amino acids KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TSHR Blocking Peptide, (ABIN939888), is also available for use as a blocking control in assays to test for specificity of this TSHR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSHR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSH receptor

Antigène: TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))

Autre désignation: TSHR

Sujet: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis