AADAT anticorps (Middle Region)

N° du produit ABIN631490

L’anticorps anti-AADAT Polyclonal Lapin est utilisé pour la détection de AADAT dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour AADAT anticorps (Middle Region) (ABIN631490)

Antigène: AADAT (Aminoadipate Aminotransferase (AADAT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AADAT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AADAT anticorps

Épitope: Middle Region

Specificité: AADAT antibody was raised against the middle region of AADAT

Purification: Affinity purified

Immunogène: AADAT antibody was raised using the middle region of AADAT corresponding to a region with amino acids EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AADAT Blocking Peptide, (ABIN937877), is also available for use as a blocking control in assays to test for specificity of this AADAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AADAT

Antigène: AADAT (Aminoadipate Aminotransferase (AADAT))

Autre désignation: AADAT

Sujet: AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities.

Poids moléculaire: 47 kDa (MW of target protein)