Calicin anticorps (C-Term)

N° du produit ABIN631496

Détail du produit anti-Calicin anticorps

Antigène: Calicin (CCIN)

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Calicin est non-conjugé

Application: Western Blotting (WB)

Specificité: Calicin antibody was raised against the C terminal of CCIN

Purification: Affinity purified

Immunogène: Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calicin Blocking Peptide, catalog no. 33R-9333, is also available for use as a blocking control in assays to test for specificity of this Calicin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Calicin

Antigène: Calicin (CCIN)

Autre désignation: Calicin (CCIN Produits)

Synonymes: anticorps CCIN, anticorps BTBD20, anticorps 4933417A14Rik, anticorps calicin, anticorps CCIN, anticorps Ccin

Sujet: CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.

Poids moléculaire: 65 kDa (MW of target protein)