NAT9 anticorps

N° du produit ABIN631510

Détail du produit anti-NAT9 anticorps

Antigène: NAT9 (N-Acetyltransferase 9 (NAT9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAT9 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NAT9 Blocking Peptide, catalog no. 33R-6370, is also available for use as a blocking control in assays to test for specificity of this NAT9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAT9

Antigène: NAT9 (N-Acetyltransferase 9 (NAT9))

Autre désignation: NAT9 (NAT9 Produits)

Synonymes: anticorps EBSP, hNATL, anticorps 1110028N05Rik, anticorps N-acetyltransferase 9 (putative), anticorps N-acetyltransferase 9 (GCN5-related, putative), anticorps NAT9, anticorps Nat9

Sujet: N-acetyltransferase 9 is an enzyme that in humans is encoded by the NAT9 gene.

Poids moléculaire: 23 kDa (MW of target protein)