ACAA1 anticorps

N° du produit ABIN631524

Cet anticorps anti-ACAA1 est un anticorps Lapin Polyclonal détectant ACAA1 dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour ACAA1 anticorps (ABIN631524)

Antigène: ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACAA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACAA1 anticorps

Purification: Affinity purified

Immunogène: ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACAA1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ACAA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACAA1

Antigène: ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))

Autre désignation: ACAA1

Sujet: ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process