DRG1 anticorps (Middle Region)

N° du produit ABIN631526

L’anticorps anti-DRG1 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de DRG1 dans des échantillons provenant de Humain, Souris et Rat. }

Aperçu rapide pour DRG1 anticorps (Middle Region) (ABIN631526)

Antigène: DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DRG1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DRG1 anticorps

Épitope: Middle Region

Specificité: DRG1 antibody was raised against the middle region of DRG1

Purification: Affinity purified

Immunogène: DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DRG1 Blocking Peptide, (ABIN5613264), is also available for use as a blocking control in assays to test for specificity of this DRG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DRG1

Antigène: DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))

Autre désignation: DRG1

Sujet: DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.

Poids moléculaire: 26 kDa (MW of target protein)