Peroxiredoxin 6 anticorps (C-Term)

N° du produit ABIN631527

Cet anticorps anti-Peroxiredoxin 6 est un anticorps Lapin Polyclonal détectant Peroxiredoxin 6 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour Peroxiredoxin 6 anticorps (C-Term) (ABIN631527)

Antigène: Peroxiredoxin 6 (PRDX6)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peroxiredoxin 6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Peroxiredoxin 6 anticorps

Épitope: C-Term

Specificité: PRDX6 antibody was raised against the C terminal of PRDX6

Purification: Affinity purified

Immunogène: PRDX6 antibody was raised using the C terminal of PRDX6 corresponding to a region with amino acids VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRDX6 Blocking Peptide, (ABIN5615540), is also available for use as a blocking control in assays to test for specificity of this PRDX6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Peroxiredoxin 6

Antigène: Peroxiredoxin 6 (PRDX6)

Autre désignation: PRDX6

Sujet: PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell, it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.

Poids moléculaire: 25 kDa (MW of target protein)