NAA30 anticorps (Middle Region)

N° du produit ABIN631528

Cet anticorps Lapin Polyclonal détecte spécifiquement NAA30 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour NAA30 anticorps (Middle Region) (ABIN631528)

Antigène: NAA30 (N(alpha)-Acetyltransferase 30, NatC Catalytic Subunit (NAA30))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAA30 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NAA30 anticorps

Épitope: Middle Region

Specificité: NAT12 antibody was raised against the middle region of NAT12

Purification: Affinity purified

Immunogène: NAT12 antibody was raised using the middle region of NAT12 corresponding to a region with amino acids EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NAT12 Blocking Peptide, (ABIN938069), is also available for use as a blocking control in assays to test for specificity of this NAT12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAA30

Antigène: NAA30 (N(alpha)-Acetyltransferase 30, NatC Catalytic Subunit (NAA30))

Autre désignation: NAT12

Sujet: NAT12 belongs to the acetyltransferase family, MAK3 subfamily. It contains 1 N-acetyltransferase domain. It is a probable N-acetyltransferase.

Poids moléculaire: 39 kDa (MW of target protein)