RABGGTB anticorps (Middle Region)

N° du produit ABIN631532

L’anticorps anti-RABGGTB Polyclonal Lapin est utilisé pour la détection de RABGGTB dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour RABGGTB anticorps (Middle Region) (ABIN631532)

Antigène: RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RABGGTB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RABGGTB anticorps

Épitope: Middle Region

Specificité: RABGGTB antibody was raised against the middle region of RABGGTB

Purification: Affinity purified

Immunogène: RABGGTB antibody was raised using the middle region of RABGGTB corresponding to a region with amino acids PGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RABGGTB Blocking Peptide, (ABIN5615723), is also available for use as a blocking control in assays to test for specificity of this RABGGTB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RABGGTB

Antigène: RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))

Autre désignation: RABGGTB

Sujet: RABGGTB catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Poids moléculaire: 37 kDa (MW of target protein)