RABGGTB anticorps (Middle Region)

N° du produit ABIN631532

Détail du produit anti-RABGGTB anticorps

Antigène: RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RABGGTB est non-conjugé

Application: Western Blotting (WB)

Specificité: RABGGTB antibody was raised against the middle region of RABGGTB

Purification: Affinity purified

Immunogène: RABGGTB antibody was raised using the middle region of RABGGTB corresponding to a region with amino acids PGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RABGGTB Blocking Peptide, catalog no. 33R-7095, is also available for use as a blocking control in assays to test for specificity of this RABGGTB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RABGGTB

Antigène: RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))

Autre désignation: RABGGTB (RABGGTB Produits)

Synonymes: anticorps RABGGTB, anticorps wu:fj12b07, anticorps zgc:56443, anticorps GGTB, anticorps Rab geranylgeranyltransferase beta subunit, anticorps Rab geranylgeranyltransferase, beta subunit, anticorps Rab geranylgeranyl transferase, b subunit, anticorps Rab geranylgeranyltransferase, beta subunit S homeolog, anticorps RABGGTB, anticorps AFUA_7G04460, anticorps NFIA_025430, anticorps ACLA_006160, anticorps PMAA_088560, anticorps AFLA_073740, anticorps TSTA_124030, anticorps TRV_03221, anticorps rabggtb, anticorps Rabggtb, anticorps rabggtb.S

Sujet: RABGGTB catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Poids moléculaire: 37 kDa (MW of target protein)