QTRT1 anticorps

N° du produit ABIN631538

Détail du produit anti-QTRT1 anticorps

Antigène: QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp QTRT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

QTRT1 Blocking Peptide, catalog no. 33R-3000, is also available for use as a blocking control in assays to test for specificity of this QTRT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur QTRT1

Antigène: QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))

Autre désignation: QTRT1 (QTRT1 Produits)

Synonymes: anticorps CG4947, anticorps Dmel\\CG4947, anticorps TGT, anticorps tgt, anticorps zgc:66378, anticorps FP3235, anticorps TGUT, anticorps 2610028E17Rik, anticorps Tgt, anticorps Tgut, anticorps tRNA-guanine transglycosylase, anticorps queuine tRNA-ribosyltransferase 1 S homeolog, anticorps queuine tRNA-ribosyltransferase 1, anticorps queuine tRNA-ribosyltransferase catalytic subunit 1, anticorps Tgt, anticorps Olsu_0732, anticorps Palpr_1298, anticorps Riean_1227, anticorps Calni_1240, anticorps Ftrac_0312, anticorps Ocepr_1541, anticorps Sulku_0977, anticorps Tmar_0854, anticorps Bache_2323, anticorps Nitsa_1291, anticorps Isop_1657, anticorps Despr_0021, anticorps Pedsa_1842, anticorps Corgl_1148, anticorps Mahau_0921, anticorps Theth_0831, anticorps qtrt1.S, anticorps qtrt1, anticorps QTRT1, anticorps Qtrt1

Sujet: TRNA-guanine transglycosylase synthesizes queuosine (Q), which is found in tRNAs that recognise NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kDa. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60 kDa subunit and a 43 kDa catalytic subunit

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process