PWWP2A anticorps (C-Term)

N° du produit ABIN631539

Détail du produit anti-PWWP2A anticorps

Antigène: PWWP2A (PWWP Domain Containing 2A (PWWP2A))

Épitope: C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PWWP2A est non-conjugé

Application: Western Blotting (WB)

Specificité: PWWP2 A antibody was raised against the C terminal of PWWP2

Purification: Affinity purified

Immunogène: PWWP2 A antibody was raised using the C terminal of PWWP2 corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PWWP2A Blocking Peptide, catalog no. 33R-7313, is also available for use as a blocking control in assays to test for specificity of this PWWP2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWWP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PWWP2A

Antigène: PWWP2A (PWWP Domain Containing 2A (PWWP2A))

Autre désignation: PWWP2A (PWWP2A Produits)

Synonymes: anticorps MST101, anticorps 4631424J17Rik, anticorps AI891583, anticorps AU024105, anticorps D930040F23Rik, anticorps RGD1305891, anticorps PWWP domain containing 2A, anticorps PWWP2A, anticorps Pwwp2a

Sujet: PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown.

Poids moléculaire: 61 kDa (MW of target protein)