PWWP2B anticorps (N-Term)

N° du produit ABIN631542

Détail du produit anti-PWWP2B anticorps

Antigène: PWWP2B (PWWP Domain Containing 2B (PWWP2B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PWWP2B est non-conjugé

Application: Western Blotting (WB)

Specificité: PWWP2 B antibody was raised against the N terminal of PWWP2

Purification: Affinity purified

Immunogène: PWWP2 B antibody was raised using the N terminal of PWWP2 corresponding to a region with amino acids ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PWWP2B Blocking Peptide, catalog no. 33R-4054, is also available for use as a blocking control in assays to test for specificity of this PWWP2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWWP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PWWP2B

Antigène: PWWP2B (PWWP Domain Containing 2B (PWWP2B))

Autre désignation: PWWP2B (PWWP2B Produits)

Synonymes: anticorps PWWP2, anticorps RP11-273H7.1, anticorps bA432J24.1, anticorps pp8607, anticorps Pwwp2, anticorps AI594893, anticorps D7Ertd517e, anticorps D930023J19Rik, anticorps PWWP2B, anticorps MGC140452, anticorps PWWP domain containing 2B, anticorps PWWP2B, anticorps Pwwp2b

Sujet: The function of PWWP2B protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 53 kDa (MW of target protein)