TTC16 anticorps (C-Term)

N° du produit ABIN631543

Cet anticorps Lapin Polyclonal détecte spécifiquement TTC16 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TTC16 anticorps (C-Term) (ABIN631543)

Antigène: TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC16 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TTC16 anticorps

Épitope: C-Term

Specificité: TTC16 antibody was raised against the C terminal of TTC16

Purification: Affinity purified

Immunogène: TTC16 antibody was raised using the C terminal of TTC16 corresponding to a region with amino acids RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTC16 Blocking Peptide, (ABIN5616837), is also available for use as a blocking control in assays to test for specificity of this TTC16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC16

Antigène: TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))

Autre désignation: TTC16

Sujet: TTC16 contains 8 TPR repeats. The exact function of TTC16 remains unknown.

Poids moléculaire: 98 kDa (MW of target protein)