NSUN4 anticorps (N-Term)

N° du produit ABIN631550

Détail du produit anti-NSUN4 anticorps

Antigène: NSUN4 (NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSUN4 est non-conjugé

Application: Western Blotting (WB)

Specificité: NSUN4 antibody was raised against the N terminal of NSUN4

Purification: Affinity purified

Immunogène: NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSUN4 Blocking Peptide, catalog no. 33R-7616, is also available for use as a blocking control in assays to test for specificity of this NSUN4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSUN4

Antigène: NSUN4 (NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4))

Autre désignation: NSUN4 (NSUN4 Produits)

Synonymes: anticorps 2310010O12Rik, anticorps 2810405F18Rik, anticorps AI507900, anticorps Shtap, anticorps RP4-603I14.2, anticorps SHTAP, anticorps RGD1559652, anticorps NOL1/NOP2/Sun domain family, member 4, anticorps NOP2/Sun RNA methyltransferase family member 4, anticorps NOP2/Sun RNA methyltransferase family member 4 S homeolog, anticorps Nsun4, anticorps NSUN4, anticorps nsun4.S

Sujet: NSUN4 may have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Poids moléculaire: 43 kDa (MW of target protein)