LOC652618 anticorps (N-Term)

N° du produit ABIN631555

Cet anticorps Lapin Polyclonal détecte spécifiquement LOC652618 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour LOC652618 anticorps (N-Term) (ABIN631555)

Antigène: LOC652618

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit anti-LOC652618 anticorps

Épitope: N-Term

Specificité: LOC652618 antibody was raised against the N terminal Of Loc652618

Purification: Affinity purified

Immunogène: LOC652618 antibody was raised using the N terminal Of Loc652618 corresponding to a region with amino acids MAGRSGHVDVVNERRLKPLYDNLDNGNYKMALQAADKLLKKHKDLHCAKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC652618 Blocking Peptide, (ABIN5614531), is also available for use as a blocking control in assays to test for specificity of this LOC652618 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652618 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LOC652618

Antigène: LOC652618

Autre désignation: LOC652618

Sujet: The function of LOC652618 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 14 kDa (MW of target protein)