LOC652825 (Middle Region) anticorps

N° du produit ABIN631556

Détail du produit

Antigène: LOC652825

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Specificité: LOC652825 antibody was raised against the middle region of Loc652825

Purification: Affinity purified

Immunogène: LOC652825 antibody was raised using the middle region of Loc652825 corresponding to a region with amino acids QSRSFRILWLLEEIKQPYELKRYYRDSSTHLAPDSLKTIHPLGKSPVLEW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC652825 Blocking Peptide, catalog no. 33R-7735, is also available for use as a blocking control in assays to test for specificity of this LOC652825 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652825 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: LOC652825

Sujet: The function of LOC652825 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 35 kDa (MW of target protein)